PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Lus10034133
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Malpighiales; Linaceae; Linum
Family MYB
Protein Properties Length: 950aa    MW: 106712 Da    PI: 5.1746
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Lus10034133genomeBGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding43.19.5e-14853248
                     SSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding  2 grWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                     g W   Ede+l+ av ++G+++W++I++ +  ++++kqck rw+ +l
      Lus10034133  8 GVWKNTEDEILKAAVMKYGKNQWARISSLLV-RKSAKQCKARWYEWL 53
                     78*****************************.************986 PP

2Myb_DNA-binding32.81.6e-1060103248
                      SSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding   2 grWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48 
                        WT eEde+l+++ k++++  W+tIa  +g  Rt+ qc +r+ k+l
      Lus10034133  60 TEWTREEDEKLLHLAKLMPTQ-WRTIAPIVG--RTPSQCLERYEKLL 103
                      68*****************99.********8..**********9986 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129422.008257IPR017930Myb domain
Gene3DG3DSA:1.10.10.607.3E-18556IPR009057Homeodomain-like
SMARTSM007177.0E-15655IPR001005SANT/Myb domain
PfamPF139215.1E-131070No hitNo description
CDDcd001675.62E-121053No hitNo description
SuperFamilySSF466897.19E-2133107IPR009057Homeodomain-like
CDDcd116591.59E-3055106No hitNo description
Gene3DG3DSA:1.10.10.603.1E-1457104IPR009057Homeodomain-like
PROSITE profilePS5129416.44358107IPR017930Myb domain
SMARTSM007171.7E-1258105IPR001005SANT/Myb domain
PfamPF118313.3E-55425666IPR021786Pre-mRNA splicing factor component Cdc5p/Cef1
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009870Biological Processdefense response signaling pathway, resistance gene-dependent
GO:0010204Biological Processdefense response signaling pathway, resistance gene-independent
GO:0042742Biological Processdefense response to bacterium
GO:0050832Biological Processdefense response to fungus
GO:0009507Cellular Componentchloroplast
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 950 aa     Download sequence    Send to blast
MRIMIKGGVW KNTEDEILKA AVMKYGKNQW ARISSLLVRK SAKQCKARWY EWLDPSIKKT  60
EWTREEDEKL LHLAKLMPTQ WRTIAPIVGR TPSQCLERYE KLLDAACVKD DNYEPSDDPR  120
KLRPGEIDPN PESKPARPDP VDMDEDEKEM LSEARARLAN TRGKKAKRKA REKQLEEARR  180
LASLQKRREL KAAGIDARQR RRKRKGIDYN SEIPFEKRPP PGFYDVADED RTVEQPMFPT  240
TIEELEGKRR VDVEAQLRKQ DIAKNKIAQR QDAPAAILQA NKLNDPETVR KRSKLMLPAP  300
QISNEDLAEI AKMGYASDLI AESEELTGGS GATRALLVNY AQTPHQGMTP LRTPQRTPAG  360
KGDAIMMEAE NLARLRESQT PLLGGDNPEL HPSDFSGVTP KKREIQTPNP MLTPSMTPSM  420
TPSMTPGRAG VTPRIGMTPS RDGYSFAMTP KGTPIRDELH INEDMDMHDS GKLERRKQAD  480
LRENLRTGLS NLPQPRNEYQ IVVQPPPEDS EEPEEKIEED MSDRMAREKA EEEARLQALL  540
RKRSKVLQRE LPRPPAASLE LIRSSLQRAD GDKSSFVPPT VIEQADELVR KELLSLLEHD  600
NAKYPLEEKQ SKEKKKGTKR SANGTAASIP IIEDFEEDEL KEADSLIRAE AQHVRVAMGH  660
KEESLEEFVD AHKTCLNDLT YFPTRAAYGL SSVAGNVEKL AALQYEFENV KTRLEAEREK  720
ALRLEKKVNV LTQGYQIRAE RQLIPPIESI LKQIDTARTE LECFQALQKQ EQLAASHRIN  780
GLWEEVQKQK ELEKTLQKRY GDLASELERM QLLANHYREQ AKQEEIAAGN QAVELATVDA  840
ADQVAMPNTE SSEIMSTDGA IPADETAQKE INHSGTENLN AVSGQDNPDA DAELVVSTAV  900
DGAAISEDLK QGLDETNPCG GKNRVEDAVE VSATEGEGKS ESNDVIMTE*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
3jb9_W1e-10332242236Pre-mRNA-splicing factor cdc5
Search in ModeBase
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1185204KRRELKAAGIDARQRRRKRK
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00028SELEXTransfer from AT1G09770Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_002521973.10.0PREDICTED: cell division cycle 5-like protein
SwissprotP929480.0CDC5L_ARATH; Cell division cycle 5-like protein
TrEMBLB9S7K40.0B9S7K4_RICCO; Cell division control protein, putative
STRINGPOPTR_0013s04340.10.0(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF40723354
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G09770.10.0cell division cycle 5